PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 281aa    MW: 30657.2 Da    PI: 8.9968
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06326.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-392080262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknkk+s
  KHN06326.1 20 PQEQLNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKKVS 80
                6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-261976IPR003851Zinc finger, Dof-type
PfamPF027011.5E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1242478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEGMAPNSCA RPVLEKKTRP QEQLNCPRCN STNTKFCYYN NYSLTQPRYF CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKKVS VTASSSSSPK VPDLNPPINL SSVSAISSQN PKIMHGGQDL  120
NLAFPAMEKY HHGMPPYVEM QNSDTTTTHH HHQTSSSCSA PPASLSALEL LRSSMASRGL  180
NPYAPSSSLM PNSTNSNALY SSGFPMQEVK PSLNFSSADG MGNRSYDHHQ IQERGGGRLL  240
FPFGDVKQLS AAAGADQVEH NKEQQGNSTG YWTGMIGEGT W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572670.0DQ857267.1 Glycine max Dof17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236720.10.0Dof17
SwissprotQ433851e-63DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A0B2PAT00.0A0A0B2PAT0_GLYSO; Dof zinc finger protein DOF3.7
TrEMBLI1KHT60.0I1KHT6_SOYBN; Uncharacterized protein
STRINGGLYMA07G05950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.42e-53Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]